PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009614003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LFY
Protein Properties Length: 414aa    MW: 46324.2 Da    PI: 7.0522
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009614003.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY6434.3e-19613961386
         FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseap.........leaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeel 86 
                     mdpeafsaslfkwdpr a+ +pp+rlle a+++++p         l+aa ++ +r+l +leelf+ayG+ry+t+akiaelGftv+tL+dmkdeel
  XP_009614003.1   1 MDPEAFSASLFKWDPRGAM-PPPTRLLEAAVAPPPPppalpppqpLSAAYSIRTRELGGLEELFQAYGIRYYTAAKIAELGFTVNTLLDMKDEEL 94 
                     9**************9877.77778888887777666777554434444444455566************************************* PP

         FLO_LFY  87 ddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeg.lseepvqe.ekeaagsggeglgeaelvaaee. 178
                     dd+m+sls+ifr++llvGeryGikaa+raerrrleeee  ++r +lls+  ++aldalsqe+ lseepvq+ e+ea+gsgg+g +++e+vaa   
  XP_009614003.1  95 DDMMNSLSQIFRWELLVGERYGIKAAIRAERRRLEEEE-LRRRGHLLSDGGTNALDALSQEVgLSEEPVQQqEREAVGSGGGG-TTWEVVAAVGg 187
                     ************************************88.8888899999999*********55******99456677777776.88888877654 PP

         FLO_LFY 179 .kkseeekkkaskk.kqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiak 271
                      + +++++kk  ++ +++r +  +++++e+++e +e++ + +++g + +erqrehPfivtepgevargkknGLDYLf+LyeqCr+fL+qvq+iak
  XP_009614003.1 188 gRMKQRRRKKVVSTgRERRGR-ASAEEDEETEEGQEDEWNINDAGGGISERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAK 281
                     344444444444442333333.333444555555555566667777778********************************************** PP

         FLO_LFY 272 erGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLs 366
                     erGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdid++fnahprL+
  XP_009614003.1 282 ERGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGAWRQACYKPLVAIAARQGWDIDTIFNAHPRLA 376
                     *********************************************************************************************** PP

         FLO_LFY 367 iWYvPtkLrqLChlerskas 386
                     iWYvPt+LrqLCh ers+a+
  XP_009614003.1 377 IWYVPTRLRQLCHSERSNAA 396
                     *****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.3E-2091396IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MDPEAFSASL FKWDPRGAMP PPTRLLEAAV APPPPPPALP PPQPLSAAYS IRTRELGGLE  60
ELFQAYGIRY YTAAKIAELG FTVNTLLDMK DEELDDMMNS LSQIFRWELL VGERYGIKAA  120
IRAERRRLEE EELRRRGHLL SDGGTNALDA LSQEVGLSEE PVQQQEREAV GSGGGGTTWE  180
VVAAVGGGRM KQRRRKKVVS TGRERRGRAS AEEDEETEEG QEDEWNINDA GGGISERQRE  240
HPFIVTEPGE VARGKKNGLD YLFHLYEQCR DFLIQVQNIA KERGEKCPTK VTNQVFRYAK  300
KAGASYINKP KMRHYVHCYA LHCLDEEASN ALRRAFKERG ENVGAWRQAC YKPLVAIAAR  360
QGWDIDTIFN AHPRLAIWYV PTRLRQLCHS ERSNAAAAAS SSVSGGVGDH LPHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1092354053173PROTEIN LEAFY
2vy2_A1e-1092354053173PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869280.0JQ686928.1 Nicotiana tabacum cultivar SR1 LEAFY/FLORICAULA (LFY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009614003.10.0PREDICTED: floricaula/leafy homolog 1 isoform X1
SwissprotQ405040.0FL1_TOBAC; Floricaula/leafy homolog 1
TrEMBLV9LXP00.0V9LXP0_TOBAC; LEAFY/FLORICAULA
STRINGSolyc03g118160.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-144floral meristem identity control protein LEAFY (LFY)